PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G1147
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 159aa    MW: 18431.1 Da    PI: 8.1887
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G1147genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.36.7e-134096561
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                 ++ +r+ +NRe+ArrsR RK+++++ L ++v +L++ N++  ++++  ++ + +++s
  Gh_D11G1147 40 RKRKRMLSNRESARRSRMRKQKRLQDLVQEVSALQKDNSQISERISVATQCYIEMQS 96
                 57899*************************************999877776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-1636100IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-103785No hitNo description
PROSITE profilePS5021710.7373885IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-114094No hitNo description
PfamPF001706.0E-114097IPR004827Basic-leucine zipper domain
CDDcd147027.09E-184191No hitNo description
PROSITE patternPS0003604358IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MSYAIIMRRI RILHSFSVVF LYWSASSSDS DPQYANIDER KRKRMLSNRE SARRSRMRKQ  60
KRLQDLVQEV SALQKDNSQI SERISVATQC YIEMQSANNV LRAQAMELTE RLRSLNSVLQ  120
VVEEVGGYAV DIPEIPEPWQ LPCPIQPIMA SVDMFEYDG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13960RKRKRMLSNRESARRSRMRKQK
25259RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.97401e-163boll| ovule| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490328.13e-94PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP83e-62BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A0D2TDR41e-112A0A0D2TDR4_G
STRINGPOPTR_0002s19720.15e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-63basic region/leucine zipper motif 53